PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004516685.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 345aa    MW: 40287.5 Da    PI: 8.345
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004516685.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.76.4e-181151343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i+ +  r++tf kR+ng+lKK +E S+LCd++v+vi+++++
  XP_004516685.1 11 IQKEKSRKTTFQKRKNGLLKKVNEFSILCDVDVCVILYAPN 51
                    778889********************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.4E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.843161IPR002100Transcription factor, MADS-box
CDDcd001202.21E-22251No hitNo description
SuperFamilySSF554559.94E-21299IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-13323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-132338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-133859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRGRISMEL IQKEKSRKTT FQKRKNGLLK KVNEFSILCD VDVCVILYAP NFEGQGYAEP  60
ETWPKDKKEV QRILQKYFNT TIDRRPKIYD VQEYFKERMK KVEFEISKVR KEMLKIMYPT  120
WDESFNSLSE EQLRLFASIL DSKLDACNQK MNMLQGDVKG KAKVESNKVE KPIAPYLASN  180
SSNYYNLMQN NMPQAQIFHP LINISDKNNL AFWQFQTGQS SQSSPMFVNA QGSYQGESSD  240
EGRYMQSYPW KQVDANSINW ANQVDGNVIY DSKFDMKNKD EAENDQNLSP YYYNGNTLAM  300
QSYPIAMQNI PFQNFQNQPQ GFQFNGYSDM DILQAHMLNY MDGRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004516685.10.0PREDICTED: MADS-box transcription factor 20-like
TrEMBLA0A072U6V50.0A0A072U6V5_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA08G10080.13e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-28M-type_MADS family protein